TA335157 RPL5 antibody

Rabbit polyclonal Anti-RPL5 Antibody

See related secondary antibodies

Search for all "RPL5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine RPL5

TA335157

More Views

  • TA335157

Product Description for RPL5

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine RPL5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPL5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 60S ribosomal protein L5
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P46777
Immunogen:
The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP.
GeneID:
6125
Application WB
Background RPL5 is required for rR maturation and formation of the 60S ribosomal subunits. This protein binds 5S R.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rR to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rR to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kise II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar R gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPL5 (4 products)

Catalog No. Species Pres. Purity   Source  

RPL5 (1-297, His-tag)

RPL5 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

RPL5 (1-297, His-tag)

RPL5 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

RPL5

RPL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPL5

RPL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPL5 (1 products)

Catalog No. Species Pres. Purity   Source  

RPL5 Lysate

Western Blot: RPL5 Lysate [NBL1-15541] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RPL5
  Novus Biologicals Inc.
  • LinkedIn