TA335159 RPL18 antibody

Rabbit polyclonal Anti-RPL18 Antibody

See related secondary antibodies

Search for all "RPL18"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Zebrafish RPL18

TA335159

More Views

  • TA335159

Product Description for RPL18

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Zebrafish RPL18.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPL18

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 60S ribosomal protein L18
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q07020
Immunogen:
The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR.
GeneID:
6141
Application WB
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPL18 (5 products)

Catalog No. Species Pres. Purity   Source  

RPL18

RPL18 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RPL18

RPL18 Human Purified
  Abnova Taiwan Corp.

RPL18

RPL18 Human Purified
  Abnova Taiwan Corp.

RPL18

RPL18 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPL18

RPL18 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPL18 (1 products)

Catalog No. Species Pres. Purity   Source  

RPL18 Lysate

Western Blot: RPL18 Lysate [NBL1-15511] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for RPL18.
  Novus Biologicals Inc.
  • LinkedIn