TA335163 ERCC6 antibody

Rabbit Polyclonal Anti-ERCC6 Antibody

See related secondary antibodies

Search for all "ERCC6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ERCC6

Product Description for ERCC6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ERCC6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ERCC6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-dependent helicase ERCC6, Cockayne syndrome protein CSB, DNA excision repair protein ERCC-6, ERCC-6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q03468
Immunogen:
The immunogen for anti-ERCC6 antibody is: synthetic peptide directed towards the C-terminal region of Human ERCC6. Synthetic peptide located within the following region: EASALLPTTEHDDLLVEMRNFIAFQAHTDGQASTREILQEFESKLSASQS.
GeneID:
2074
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ERCC6 (3 products)

Catalog No. Species Pres. Purity   Source  

ERCC6

ERCC6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

ERCC6

ERCC6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ERCC6

ERCC6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn