TA335193 FOXC1 / FKHL7 / FREAC3 antibody

Rabbit Polyclonal Anti-FOXC1 Antibody

See related secondary antibodies

Search for all "FOXC1 / FKHL7 / FREAC3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat, Zebrafish FOXC1 / FKHL7 / FREAC3

Product Description for FOXC1 / FKHL7 / FREAC3

Rabbit anti Human, Mouse, Rat, Zebrafish FOXC1 / FKHL7 / FREAC3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXC1 / FKHL7 / FREAC3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FREAC-3, Forkhead box protein C1, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3
Presentation Purified
Reactivity Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12948
Immunogen:
The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC.
GeneID:
2296
Application WB
Background FOXC1 belongs to the forkhead family of transcription factors which is characterized by a distinct D-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal domint iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXC1 / FKHL7 / FREAC3 (2 products)

Catalog No. Species Pres. Purity   Source  

FOXC1 / FKHL7 / FREAC3

FOXC1 / FKHL7 / FREAC3 Human Purified
  Abnova Taiwan Corp.

FOXC1 / FKHL7 / FREAC3

FOXC1 / FKHL7 / FREAC3 Human 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FOXC1 / FKHL7 / FREAC3 (1 products)

Catalog No. Species Pres. Purity   Source  

FOXC1 Lysate

Western Blot: FOXC1 Lysate [NBL1-10801] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FOXC1
  Novus Biologicals Inc.
  • LinkedIn