TA335220 P protein antibody

Rabbit Polyclonal Anti-OCA2 Antibody

See related secondary antibodies

Search for all "P protein"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat P protein

Product Description for P protein

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat P protein.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for P protein

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms D15S12, Melanocyte-specific transporter protein, OCA2, Pink-eyed dilution protein homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q04671
Immunogen:
The immunogen for anti-OCA2 antibody: synthetic peptide directed towards the middle region of human OCA2. Synthetic peptide located within the following region: LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC.
GeneID:
4948
Application WB
Background OCA2 is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in the gene encoding OCA2 result in type 2 oculocutaneous albinism.This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for P protein (2 products)

Catalog No. Species Pres. Purity   Source  

P protein

P protein Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

P protein

P protein Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for P protein (1 products)

Catalog No. Species Pres. Purity   Source  

OCA2 overexpression lysate

OCA2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn