TA335236 Sialidase 1 antibody

Rabbit Polyclonal Anti-NEU1 Antibody

See related secondary antibodies

Search for all "Sialidase 1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat Sialidase 1

TA335236

More Views

  • TA335236

Product Description for Sialidase 1

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat Sialidase 1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Sialidase 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acetylneuraminyl hydrolase, G9 sialidase, Lysosomal sialidase, N-acetyl-alpha-neuraminidase 1, NANH, NEU1, Sialidase-1
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99519
Immunogen:
The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG.
GeneID:
4758
Application WB
IHC
Background NEU1 is a lysosomal enzyme, which cleaves termil sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.The protein encoded by this gene encodes the lysosomal enzyme, which cleaves termil sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Sialidase 1 (7 products)

Catalog No. Species Pres. Purity   Source  

Sialidase 1

Sialidase 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Sialidase 1

Sialidase 1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

Sialidase 1 (48-415, His-tag)

Sialidase 1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

Sialidase 1 (48-415, His-tag)

Sialidase 1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

Sialidase 1

Sialidase 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Sialidase 1

Sialidase 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Sialidase 1

Sialidase 1 Human
  Abnova Taiwan Corp.

Positive controls for Sialidase 1 (1 products)

Catalog No. Species Pres. Purity   Source  

Neuraminidase Lysate

Western Blot: Neuraminidase Lysate [NBL1-13594] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NEU1
  Novus Biologicals Inc.
  • LinkedIn