TA335238 Presenilin-2 antibody

Rabbit Polyclonal Anti-Psen2 Antibody

See related secondary antibodies

Search for all "Presenilin-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Presenilin-2

Product Description for Presenilin-2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Presenilin-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Presenilin-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AD3LP, AD4, AD5, Alzheimer disease 4, E5-1, PS2, PSEN2, PSNL2, Presenilin 2, STM-2, STM2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49810
Immunogen:
The immunogen for anti-Psen2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Psen2. Synthetic peptide located within the following region: TAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYD.
GeneID:
5664
Application WB
Background This gene mutations in human homolog responsible for chromosome 1-linked familial Alzheimer's disease; expression increased during brain development but decreased in the adult.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Presenilin-2 (2 products)

Catalog No. Species Pres. Purity   Source  

Presenilin-2

Presenilin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Presenilin-2

Presenilin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Presenilin-2 (1 products)

Catalog No. Species Pres. Purity   Source  

PSEN2 overexpression lysate

PSEN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn