TA335246 Thyroid peroxidase (TPO) antibody

Rabbit Polyclonal Anti-TPO Antibody

See related secondary antibodies

Search for all "Thyroid peroxidase (TPO)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast Thyroid peroxidase (TPO)

Product Description for Thyroid peroxidase (TPO)

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast Thyroid peroxidase (TPO).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Thyroid peroxidase (TPO)

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P07202
Immunogen:
The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS.
GeneID:
7173
Application WB
Background This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodition of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodited tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but the full-length ture of some variants has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Thyroid peroxidase (TPO) (13 products)

Catalog No. Species Pres. Purity   Source  

Thyroid peroxidase (TPO) (transcript variant 1)

Thyroid peroxidase (TPO) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified >95.0% as determined by SDS-PAGE. Insect cells
  OriGene Technologies GmbH

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified >95.0% as determined by SDS-PAGE. Insect cells
  OriGene Technologies GmbH

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified >95.0% as determined by SDS-PAGE. Insect cells
  OriGene Technologies GmbH

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human
  Abnova Taiwan Corp.

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified
  Abnova Taiwan Corp.

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified
  Abnova Taiwan Corp.

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human
  Abnova Taiwan Corp.

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified > 90 % Thyroid
  BBI Solutions

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified > 96 % SF9 cells
  BBI Solutions

Thyroid peroxidase (TPO)

Thyroid peroxidase (TPO) Human Purified > 90 % Thyroid
1 mg / €3,390.00
  HyTest Ltd.

Positive controls for Thyroid peroxidase (TPO) (1 products)

Catalog No. Species Pres. Purity   Source  

TPO 293T Cell Transient Overexpression Lysate(Denatured)

TPO 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn