TA335280 TM6SF2 antibody

Rabbit Polyclonal Anti-TM6SF2 Antibody

See related secondary antibodies

Search for all "TM6SF2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat TM6SF2

Product Description for TM6SF2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat TM6SF2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TM6SF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane 6 superfamily member 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZW4
Immunogen:
The immunogen for anti-TM6SF2 antibody is: synthetic peptide directed towards the C-terminal region of Human TM6SF2. Synthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF.
GeneID:
53345
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn