TA335291 ZFYVE27 antibody

Rabbit Polyclonal Anti-ZFYVE27 Antibody

See related secondary antibodies

Search for all "ZFYVE27"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Porcine, Rabbit, Rat, Zebrafish ZFYVE27

Product Description for ZFYVE27

Rabbit anti Canine, Equine, Porcine, Rabbit, Rat, Zebrafish ZFYVE27.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFYVE27

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger FYVE domain-containing protein 27
Presentation Purified
Reactivity Can, Eq, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T4F4
Immunogen:
The immunogen for anti-ZFYVE27 antibody: synthetic peptide directed towards the C terminal of human ZFYVE27. Synthetic peptide located within the following region: TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC.
GeneID:
118813
Application WB
Background ZFYVE27 may be associated with the neurol intracellular trafficking in the corticospil tract, which is consistent with the pathology of HSP.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFYVE27 (4 products)

Catalog No. Species Pres. Purity   Source  

ZFYVE27 (transcript variant 2)

ZFYVE27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZFYVE27 (transcript variant 1)

ZFYVE27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZFYVE27 (transcript variant 6)

ZFYVE27 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZFYVE27 (transcript variant 5)

ZFYVE27 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ZFYVE27 (10 products)

Catalog No. Species Pres. Purity   Source  

ZFYVE27 Lysate

Western Blot: ZFYVE27 Lysate [NBL1-18028] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZFYVE27.
  Novus Biologicals Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ZFYVE27 overexpression lysate

ZFYVE27 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn