discontinued

TA335296 FMO3 (Center) antibody

Rabbit Polyclonal Anti-Fmo3 Antibody

See related secondary antibodies

Search for all "FMO3"

Quick Overview

Rabbit anti Human, Mouse FMO3

Product Description for FMO3

Rabbit anti Human, Mouse FMO3.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FMO3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Dimethylaniline monooxygenase [N-oxide-forming] 3, Dimethylaniline oxidase 3, FMO II, FMO form 2, Hepatic flavin-containing monooxygenase 3
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight FMO3: 60 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P97501
Immunogen:
Synthetic peptide corresponding to a middle region of mouse FMO3
AA Sequence:
KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE
GeneID:
14262
Property Center
Application

Western blotting  (1 µg/ml).

Background This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides.
General Readings "Molecular cloning, sequencing, and expression in Escherichia coli of mouse flavin-containing monooxygenase 3 (FMO3): comparison with the human isoform." Falls J.G., Cherrington N.J., Clements K.M., Philpot R.M., Levi P.E., Rose R.L., Hodgson E. Arch. Biochem. Biophys. 347:9-18(1997) [PubMed: 9344459]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.

Accessory Products

  • LinkedIn