TA335298 MCTP1 antibody

Rabbit Polyclonal Anti-Mctp1 Antibody

See related secondary antibodies

Search for all "MCTP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish MCTP1

Product Description for MCTP1

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish MCTP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MCTP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Multiple C2 and transmembrane domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6DN14-2
Immunogen:
The immunogen for anti-Mctp1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mctp1. Synthetic peptide located within the following region: LAARDRGGTSDPYVKFKIGRKEVFRSKIIHKNLNPVWEEKACVLIDHLRE.
GeneID:
79772
Application WB
Background Mctp1 is a sugar transporter that specifically mediates the transport of UDP-xylose (UDP-Xyl) and UDP-N-acetylglucosamine (UDP-Glcc) from cytosol into Golgi.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn