TA335316 TMEM195 antibody

Rabbit Polyclonal Anti-TMEM195 Antibody

See related secondary antibodies

Search for all "TMEM195"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Porcine, Rabbit, Rat TMEM195

Product Description for TMEM195

Rabbit anti Canine, Human, Mouse, Porcine, Rabbit, Rat TMEM195.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM195

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane protein 195
Presentation Purified
Reactivity Can, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZNB7
Immunogen:
The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the N terminal of human TMEM195. Synthetic peptide located within the following region: VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP.
GeneID:
392636
Application WB
Background TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn