TA335321 ONECUT3 antibody

Rabbit Polyclonal Anti-ONECUT3 Antibody

See related secondary antibodies

Search for all "ONECUT3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Porcine ONECUT3

Product Description for ONECUT3

Rabbit anti Bovine, Human, Porcine ONECUT3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ONECUT3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms One cut domain family member 3, One cut homeobox 3, Transcription factor ONECUT-3
Presentation Purified
Reactivity Bov, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60422
Immunogen:
The immunogen for Anti-ONECUT3 Antibody: synthetic peptide directed towards the C terminal of human LOC390874. Synthetic peptide located within the following region: VTISQQLGLELNTVSNFFMNARRRCMNRWAEEPSTAPGGPAGATATFSKA.
GeneID:
390874
Application WB
Background LOC390874 is a new protein with unknown function
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ONECUT3 (1 products)

Catalog No. Species Pres. Purity   Source  

ONECUT3 overexpression lysate

ONECUT3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn