TA335326 FAM177B antibody

Rabbit Polyclonal Anti-FAM177B Antibody

See related secondary antibodies

Search for all "FAM177B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM177B

Product Description for FAM177B

Rabbit anti Human FAM177B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM177B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6PVY3
Immunogen:
The immunogen for Anti-FAM177B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM177B. Synthetic peptide located within the following region: YRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVQEYGTIQQDVTEAIP.
GeneID:
400823
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM177B (1 products)

Catalog No. Species Pres. Purity   Source  

FAM177B

FAM177B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FAM177B (1 products)

Catalog No. Species Pres. Purity   Source  

FAM177B overexpression lysate

FAM177B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn