TA335329 FAM45A antibody

Rabbit Polyclonal Anti-FAM45A Antibody

See related secondary antibodies

Search for all "FAM45A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat FAM45A

Product Description for FAM45A

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat FAM45A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM45A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TCE6
Immunogen:
The immunogen for Anti-FAM45A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM45A. Synthetic peptide located within the following region: GQLIVQSAEDPEKSESHVIQDIALKTREIFTNLAPFSEVSADGEKRVLNL.
GeneID:
404636
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM45A (3 products)

Catalog No. Species Pres. Purity   Source  

FAM45A

FAM45A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FAM45A

FAM45A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FAM45A

FAM45A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FAM45A (2 products)

Catalog No. Species Pres. Purity   Source  

FAM45A Lysate

Western Blot: FAM45A Lysate [NBL1-10529] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FAM45A
  Novus Biologicals Inc.

FAM45A overexpression lysate

FAM45A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn