TA335332 FAM86A antibody

Rabbit Polyclonal Anti-FAM86A Antibody

See related secondary antibodies

Search for all "FAM86A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat FAM86A

Product Description for FAM86A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat FAM86A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM86A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SB153
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96G04
Immunogen:
The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE.
GeneID:
196483
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM86A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM86A (transcript variant 1)

FAM86A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FAM86A (4 products)

Catalog No. Species Pres. Purity   Source  

EEF2KMT overexpression lysate

EEF2KMT overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

EEF2KMT overexpression lysate

EEF2KMT overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

EEF2KMT overexpression lysate

EEF2KMT overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

FAM86A Lysate

Western Blot: FAM86A Lysate [NBL1-10578] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FAM86A
  Novus Biologicals Inc.
  • LinkedIn