TA335337 EFCAB5 antibody

Rabbit Polyclonal Anti-EFCAB5 Antibody

See related secondary antibodies

Search for all "EFCAB5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human EFCAB5

Product Description for EFCAB5

Rabbit anti Human EFCAB5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EFCAB5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EF-hand calcium-binding domain-containing protein 5
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4FU69
Immunogen:
The immunogen for Anti-EFCAB5 Antibody is: synthetic peptide directed towards the C-terminal region of Human EFCAB5. Synthetic peptide located within the following region: TEPNSPQDSKSMELEANVKLVRDILKAVILFFHPELEFSSDFGSWDKCKF.
GeneID:
374786
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for EFCAB5 (1 products)

Catalog No. Species Pres. Purity   Source  

EFCAB5 overexpression lysate

EFCAB5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn