TA335340 TEX14 antibody

Rabbit Polyclonal Anti-TEX14 Antibody

See related secondary antibodies

Search for all "TEX14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat TEX14

Product Description for TEX14

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat TEX14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TEX14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein kinase-like protein SgK307, SGK307, Sugen kinase 307, Testis-expressed protein 14, Testis-expressed sequence 14
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWB6
Immunogen:
The immunogen for Anti-TEX14 Antibody: synthetic peptide directed towards the middle region of human TEX14. Synthetic peptide located within the following region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK.
GeneID:
56155
Application WB
Background TEX14 belongs to the protein kise superfamily. It contains 3 ANK repeats and 1 protein kise domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kise activity.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TEX14 (2 products)

Catalog No. Species Pres. Purity   Source  

TEX14

TEX14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TEX14

TEX14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TEX14 (1 products)

Catalog No. Species Pres. Purity   Source  

TEX14 overexpression lysate

TEX14 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn