Home » IMPDH1 / IMPD1

TA335348 IMPDH1 / IMPD1 antibody

Rabbit Polyclonal Anti-IMPDH1 Antibody

0.1 ml / €360.00

Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish IMPDH1 / IMPD1

More Views

Product Description for IMPDH1 / IMPD1

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish IMPDH1 / IMPD1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for IMPDH1 / IMPD1

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	IMP dehydrogenase 1, IMPD 1, IMPDH 1, IMPDH-1, IMPDH-I, Inosine-5'-monophosphate dehydrogenase 1
Presentation	Purified
Reactivity	Can, Eq, Hu, Por, Rb, Rt, Ze
Applications	P, WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P20839 Immunogen: The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE. GeneID: 3614
Application	WB IHC
Background	IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).
Format	Purification: Affinity Purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IMPDH1 / IMPD1 (10 products)

Catalog No.	Species	Pres.	Purity	Source
TP307118	IMPDH1 / IMPD1 (transcript variant 2)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP315206	IMPDH1 / IMPD1 (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
AR09523PU-L	IMPDH1 / IMPD1 (1-514, His-tag)
	Human	Purified	> 95 % by SDS - PAGE	E. coli	0.25 mg / €1,070.00
					OriGene Technologies GmbH
AR09523PU-N	IMPDH1 / IMPD1 (1-514, His-tag)
	Human	Purified	> 95 % by SDS - PAGE	E. coli	50 µg / €400.00
					OriGene Technologies GmbH
H00003614-P01-10	IMPDH1 / IMPD1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00003614-P01-25	IMPDH1 / IMPD1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00003614-Q01-10	IMPDH1 / IMPD1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003614-Q01-25	IMPDH1 / IMPD1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
NBP1-45252-0.25	IMPDH1 / IMPD1
	Human	Purified
					Novus Biologicals Inc.
NBP1-45252-50	IMPDH1 / IMPD1
	Human	Purified
					Novus Biologicals Inc.

Positive controls for IMPDH1 / IMPD1 (7 products)

Catalog No.	Species
H00003614-T01	IMPDH1 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-11985	IMPDH1 Lysate

		Novus Biologicals Inc.
NBL1-11986	IMPDH1 Lysate

		Novus Biologicals Inc.
LY405238	IMPDH1 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY420173	IMPDH1 overexpression lysate
		0.1 mg / €495.00
		OriGene Technologies, Inc.
LY428185	IMPDH1 overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.
LY428186	IMPDH1 overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for IMPDH1 / IMPD1 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH

Click here to see all secondary antibodies for IMPDH1 / IMPD1

Antibodies (see all»)

Kits (see all»)

Antigens

Lysates (see all»)

Tissue Slides (see all»)

Other life-science products