TA335356 SLC25A31 antibody

Rabbit Polyclonal Anti-Slc25a31 Antibody

See related secondary antibodies

Search for all "SLC25A31"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC25A31

Product Description for SLC25A31

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC25A31.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A31

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AAC4, ADP ATP carrier protein 4, ADP/ATP translocase 4, ANT 4, ANT-4, ANT4, Adenine nucleotide translocator 4, SFEC, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3V132
Immunogen:
The immunogen for Anti-Slc25a31 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV.
GeneID:
73333
Application WB
Background Slc25a31 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It may serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn