TA335364 ATP11C (C-term) antibody

Rabbit Polyclonal Anti-Atp11c Antibody

See related secondary antibodies

Search for all "ATP11C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse ATP11C

Product Description for ATP11C

Rabbit anti Human, Mouse ATP11C.
Properties: (C-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATP11C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATPIG, ATPIQ, ATPase IG, ATPase IQ, ATPase class VI type 11C, Probable phospholipid-transporting ATPase IG
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9QZW0
Immunogen:
Synthetic peptide directed towards the middle region of mouse ATP11C
AA Sequence:
GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH
GeneID:
320940
Property C-term
Application Western blotting (0.2 - 1 µg/ml)
Background Probable phospholipid-transporting ATPase 11C is a multi-pass endoplasmatic reticulum membrane protein with the catalytic activity: ATP + H2O + phospholipid(Side 1) = ADP + phosphate + phospholipid(Side 2).
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Human, Rat, Pig, Dog, Rabbit, Guinea Pig, Horse, Bovine
Species reactivity (tested):
Mouse

Accessory Products

  • LinkedIn