TA335365 PIAS2 antibody

Rabbit Polyclonal Anti-PIAS2 Antibody

See related secondary antibodies

Search for all "PIAS2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat PIAS2

Product Description for PIAS2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat PIAS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PIAS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARIP3, Androgen receptor-interacting protein 3, DAB2-interacting protein, DIP, E3 SUMO-protein ligase PIAS2, Miz1, Msx-interacting zinc finger protein, PIAS-NY protein, PIASX, Protein inhibitor of activated STAT x, Protein inhibitor of activated STAT2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75928
Immunogen:
The immunogen for Anti-PIAS2 Antibody: synthetic peptide directed towards the N terminal of human PIAS2. Synthetic peptide located within the following region: RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST.
GeneID:
9063
Application WB
Background Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptiol coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone sigling pathway. It seems to be mostly involved in gene silencing. It binds to sumoylated ELK1 and enhances its transcriptiol activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. This gene encodes a protein involved in the regulation of transcription factors involved in MAP kise sigling. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. Two altertively spliced transcripts encoding different isoforms have been described.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PIAS2 (10 products)

Catalog No. Species Pres. Purity   Source  

PIAS2 (full length, N-term HIS tag, transcript variant beta)

PIAS2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

PIAS2

PIAS2 Human
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human
  Abnova Taiwan Corp.

PIAS2

PIAS2 Human
  Abnova Taiwan Corp.

Positive controls for PIAS2 (5 products)

Catalog No. Species Pres. Purity   Source  

PIAS2 293T Cell Transient Overexpression Lysate(Denatured)

PIAS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PIAS2 Lysate

Western Blot: PIAS2 Lysate [NBL1-14385] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PIAS2
  Novus Biologicals Inc.

PIAS2 Lysate

Western Blot: PIAS2 Lysate [NBL1-14386] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PIAS2
  Novus Biologicals Inc.

PIAS2 overexpression lysate

PIAS2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

PIAS2 overexpression lysate

PIAS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn