TA335373 FAM26E antibody

Rabbit Polyclonal Anti-FAM26E Antibody

See related secondary antibodies

Search for all "FAM26E"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat FAM26E

Product Description for FAM26E

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat FAM26E.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM26E

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf188
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5C1
Immunogen:
The immunogen for Anti-FAM26E Antibody is: synthetic peptide directed towards the middle region of Human FAM26E. Synthetic peptide located within the following region: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC.
GeneID:
254228
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM26E (1 products)

Catalog No. Species Pres. Purity   Source  

FAM26E overexpression lysate

FAM26E overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn