TA335374 NUP155 antibody

Rabbit Polyclonal Anti-NUP155 Antibody

See related secondary antibodies

Search for all "NUP155"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat NUP155

Product Description for NUP155

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat NUP155.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NUP155

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 155 kDa nucleoporin, KIAA0791, Nuclear pore complex protein Nup155, Nucleoporin Nup155
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75694
Immunogen:
The immunogen for Anti-NUP155 Antibody: synthetic peptide directed towards the N terminal of human NUP155. Synthetic peptide located within the following region: MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS.
GeneID:
9631
Application WB
Background Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectiol trafficking of molecules, especially mRs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectiol trafficking of molecules, especially mRs and proteins, between the nucleus and the cytoplasm. The protein encoded by this gene does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. Two protein isoforms are encoded by transcript variants of this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NUP155 (1 products)

Catalog No. Species Pres. Purity   Source  

NUP155 (transcript variant 1)

NUP155 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for NUP155 (1 products)

Catalog No. Species Pres. Purity   Source  

NUP155 Lysate

Western Blot: NUP155 Lysate [NBL1-13872] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NUP155
  Novus Biologicals Inc.
  • LinkedIn