TA335382 DNAJC18 antibody

Rabbit Polyclonal Anti-DNAJC18 Antibody

See related secondary antibodies

Search for all "DNAJC18"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat DNAJC18

Product Description for DNAJC18

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat DNAJC18.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAJC18

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DnaJ homolog subfamily C member 18
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H819
Immunogen:
The immunogen for Anti-DNAJC18 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAJC18. Synthetic peptide located within the following region: EWTQTRQGEGNSTYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAY.
GeneID:
202052
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC18 (2 products)

Catalog No. Species Pres. Purity   Source  

DNAJC18

DNAJC18 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DNAJC18

DNAJC18 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DNAJC18 (2 products)

Catalog No. Species Pres. Purity   Source  

DNAJC18 293T Cell Transient Overexpression Lysate(Denatured)

DNAJC18 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DNAJC18 overexpression lysate

DNAJC18 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn