TA335395 Testisin / PRSS21 antibody

Rabbit Polyclonal Anti-PRSS21 Antibody

See related secondary antibodies

Search for all "Testisin / PRSS21"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat Testisin / PRSS21

Product Description for Testisin / PRSS21

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat Testisin / PRSS21.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Testisin / PRSS21

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ESP-1, ESP1, Eosinophil serine protease 1, Serine protease 21, TEST1
Presentation Purified
Reactivity GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6M0-3
Immunogen:
The immunogen for Anti-PRSS21 Antibody: synthetic peptide directed towards the N terminal of human PRSS21. Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF.
GeneID:
10942
Application WB
Background This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Altertive splicing of this gene results in three transcript variants encoding three different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn