TA335421 CENP-L antibody

Rabbit Polyclonal Anti-CENPL Antibody

See related secondary antibodies

Search for all "CENP-L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat CENP-L

Product Description for CENP-L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat CENP-L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CENP-L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C1orf155, CENPL, Centromere protein L, ICEN33, Interphase centromere complex protein 33
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N0S6
Immunogen:
The immunogen for Anti-CENPL Antibody is: synthetic peptide directed towards the middle region of Human CENPL. Synthetic peptide located within the following region: FSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVLWTGWFCCVFGDSL.
GeneID:
91687
Application WB
Background CENPL is a subunit of a CENPH -CENPI-associated centromeric complex that targets CENPA to centromeres and is required for proper kinetochore function and mitotic progression.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CENP-L (3 products)

Catalog No. Species Pres. Purity   Source  

CENP-L (transcript variant 2)

CENP-L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CENP-L

CENP-L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CENP-L

CENP-L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CENP-L (1 products)

Catalog No. Species Pres. Purity   Source  

CENPL Lysate

Western Blot: CENPL Lysate [NBL1-09087] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CENPL.
  Novus Biologicals Inc.
  • LinkedIn