TA335493 ABHD17C antibody

Rabbit Polyclonal Anti-ABHD17C Antibody

See related secondary antibodies

Search for all "ABHD17C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish ABHD17C

Product Description for ABHD17C

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish ABHD17C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ABHD17C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FAM108C1 Alpha/beta hydrolase domain-containing protein 17C
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PCB6
Immunogen:
The immunogen for Anti-FAM108C1 Antibody is: synthetic peptide directed towards the middle region of Human FAM108C1. Synthetic peptide located within the following region: GSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENI.
GeneID:
58489
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ABHD17C (1 products)

Catalog No. Species Pres. Purity   Source  

ABHD17C overexpression lysate

ABHD17C overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn