TA335498 LYZL6 antibody

Rabbit Polyclonal Anti-LYZL6 Antibody

See related secondary antibodies

Search for all "LYZL6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat LYZL6

Product Description for LYZL6

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat LYZL6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LYZL6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LYC1, Lysozyme-like protein 6
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75951
Immunogen:
The immunogen for Anti-LYZL6 Antibody: synthetic peptide directed towards the N terminal of human LYZL6. Synthetic peptide located within the following region: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL.
GeneID:
57151
Application WB
Background LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LYZL6 (3 products)

Catalog No. Species Pres. Purity   Source  

LYZL6

LYZL6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LYZL6

LYZL6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LYZL6

LYZL6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LYZL6 (1 products)

Catalog No. Species Pres. Purity   Source  

LYZL6 Lysate

Western Blot: LYZL6 Lysate [NBL1-12774] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LYZL6
  Novus Biologicals Inc.
  • LinkedIn