TA335509 ZA20D3 antibody

Rabbit Polyclonal Anti-ZFAND6 Antibody

See related secondary antibodies

Search for all "ZA20D3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZA20D3

Product Description for ZA20D3

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZA20D3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZA20D3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AN1-type zinc finger protein 6, AWP1, Associated with PRK1 protein, HT032, ZFAND6, Zinc finger A20 domain-containing protein 3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6FIF0
Immunogen:
The immunogen for Anti-ZFAND6 Antibody: synthetic peptide directed towards the middle region of human ZFAND6. Synthetic peptide located within the following region: LTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQK.
GeneID:
54469
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZA20D3 (1 products)

Catalog No. Species Pres. Purity   Source  

ZA20D3 Lysate

Western Blot: ZA20D3 Lysate [NBL1-18015] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZFAND6
  Novus Biologicals Inc.
  • LinkedIn