TA335513 TCP11 antibody

Rabbit Polyclonal Anti-TCP11 Antibody

See related secondary antibodies

Search for all "TCP11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TCP11

Product Description for TCP11

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TCP11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TCP11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms T-complex protein 11 homolog, TCP-11
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WWU5-2
Immunogen:
The immunogen for Anti-TCP11 Antibody: synthetic peptide directed towards the middle region of human TCP11. Synthetic peptide located within the following region: DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD.
GeneID:
6954
Application WB
Background TCP11 may play an important role in sperm function and fertility.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn