TA335516 RRN3 antibody

Rabbit Polyclonal Anti-RRN3 Antibody

See related secondary antibodies

Search for all "RRN3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat RRN3

Product Description for RRN3

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat RRN3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RRN3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RNA polymerase I-specific transcription initiation factor RRN3, TIF-IA, TIFIA, Transcription initiation factor IA
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYV6
Immunogen:
he immunogen for anti-RRN3 antibody: synthetic peptide directed towards the C terminal of human RRN3.
AA Sequence:
KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM
GeneID:
54700
Application Western blotting (0.2 - 1 µg/ml)
Background RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of gene expression, namely results in rRNA synthesis in turn cell growth.
General Readings Miller,G., et al., (2001) EMBO J. 20 (6), 1373-1382
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, Chicken
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for RRN3 (4 products)

Catalog No. Species Pres. Purity   Source  

RRN3

RRN3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RRN3

RRN3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RRN3

RRN3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RRN3

RRN3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RRN3 (1 products)

Catalog No. Species Pres. Purity   Source  

RRN3 293T Cell Transient Overexpression Lysate(Denatured)

RRN3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn