TA335546 SETD4 antibody

Rabbit Polyclonal Anti-SETD4 Antibody

See related secondary antibodies

Search for all "SETD4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SETD4

TA335546

More Views

  • TA335546
  • TA335546
  • TA335546

Product Description for SETD4

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SETD4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SETD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C21orf18, C21orf27, SET domain-containing protein 4, chromosome 21 open reading frame 18
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVD3
Immunogen:
The immunogen for Anti-C21ORF18 Antibody: synthetic peptide directed towards the C terminal of human C21ORF18. Synthetic peptide located within the following region: LTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETN.
GeneID:
54093
Application WB
Background C21orf18, located on chromosome 21, is predicted to encode for a hypothetical protein.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SETD4 (1 products)

Catalog No. Species Pres. Purity   Source  

SETD4

SETD4 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SETD4 (5 products)

Catalog No. Species Pres. Purity   Source  

C21orf18 Lysate

Western Blot: C21orf18 Lysate [NBL1-15868] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SETD4
  Novus Biologicals Inc.

SETD4 293T Cell Transient Overexpression Lysate(Denatured)

SETD4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SETD4 overexpression lysate

SETD4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SETD4 overexpression lysate

SETD4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SETD4 overexpression lysate

SETD4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn