TA335580 C2orf86 antibody

Rabbit Polyclonal Anti-WDPCP Antibody

See related secondary antibodies

Search for all "C2orf86"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rabbit, Rat C2orf86

Product Description for C2orf86

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rabbit, Rat C2orf86.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C2orf86

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LOC51057, WD repeat-containing protein C2orf86
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95876-2
Immunogen:
The immunogen for Anti-WDPCP Antibody: synthetic peptide directed towards the N terminal of human LOC51057. Synthetic peptide located within the following region: LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH.
GeneID:
51057
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn