TA335581 WDR42A antibody

Rabbit Polyclonal Anti-DCAF8 Antibody

See related secondary antibodies

Search for all "WDR42A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish WDR42A

Product Description for WDR42A

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish WDR42A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR42A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms H326, WD repeat-containing protein 42A
Presentation Purified
Reactivity Bov, Eq, Hu, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TAQ9
Immunogen:
The immunogen for Anti-DCAF8 Antibody is: synthetic peptide directed towards the C-terminal region of Human DCAF8. Synthetic peptide located within the following region: LPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDL.
GeneID:
50717
Application WB
Background This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. Multiple altertively spliced transcript variants have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WDR42A (2 products)

Catalog No. Species Pres. Purity   Source  

WDR42A

WDR42A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

WDR42A

WDR42A Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for WDR42A (1 products)

Catalog No. Species Pres. Purity   Source  

WDR42A Lysate

Western Blot: WDR42A Lysate [NBL1-17808] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DCAF8
  Novus Biologicals Inc.
  • LinkedIn