TA335585 C2orf24 antibody

Rabbit Polyclonal Anti-CNPPD1 Antibody

See related secondary antibodies

Search for all "C2orf24"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C2orf24

Product Description for C2orf24

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C2orf24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C2orf24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDABP0125, CGI-57, LOC27013, Uncharacterized protein C2orf24
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BV87
Immunogen:
The immunogen for Anti-CNPPD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNPPD1. Synthetic peptide located within the following region: ISPCAMMLALVYIERLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEE.
GeneID:
27013
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C2orf24 (1 products)

Catalog No. Species Pres. Purity   Source  

C2orf24 Lysate

Western Blot: C2orf24 Lysate [NBL1-08405] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C2orf24 Protein
  Novus Biologicals Inc.
  • LinkedIn