TA335588 SAMD4A / SMAUG1 antibody

Rabbit Polyclonal Anti-SAMD4A Antibody

See related secondary antibodies

Search for all "SAMD4A / SMAUG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SAMD4A / SMAUG1

TA335588

More Views

  • TA335588
  • TA335588

Product Description for SAMD4A / SMAUG1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SAMD4A / SMAUG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SAMD4A / SMAUG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1053, SAM domain-containing protein 4A, SAMD4, Smaug 1, Smaug homolog 1, Sterile alpha motif domain-containing protein 4A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPU9
Immunogen:
The immunogen for Anti-SAMD4A Antibody: synthetic peptide directed towards the middle region of human SAMD4A. Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK.
GeneID:
23034
Application WB
Background Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an R-binding domain that functions as a posttranscriptiol regulator by binding to an R sequence motif known as the Smaug recognition element, which was med after the Drosophila Smaug protein.Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an R-binding domain that functions as a posttranscriptiol regulator by binding to an R sequence motif known as the Smaug recognition element, which was med after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SAMD4A / SMAUG1 (1 products)

Catalog No. Species Pres. Purity   Source  

SAMD4A / SMAUG1

SAMD4A / SMAUG1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SAMD4A / SMAUG1 (2 products)

Catalog No. Species Pres. Purity   Source  

SAMD4A 293T Cell Transient Overexpression Lysate(Denatured)

SAMD4A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SAMD4A overexpression lysate

SAMD4A overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn