TA335593 CNOT10 antibody

Rabbit Polyclonal Anti-CNOT10 Antibody

See related secondary antibodies

Search for all "CNOT10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat CNOT10

Product Description for CNOT10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat CNOT10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CNOT10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CCR4-NOT transcription complex subunit 10
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H9A5
Immunogen:
The immunogen for Anti-CNOT10 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNOT10. Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF.
GeneID:
25904
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CNOT10 (2 products)

Catalog No. Species Pres. Purity   Source  

CNOT10

CNOT10 Human Purified
  Abnova Taiwan Corp.

CNOT10

CNOT10 Human Purified
  Abnova Taiwan Corp.

Positive controls for CNOT10 (2 products)

Catalog No. Species Pres. Purity   Source  

CNOT10 293T Cell Transient Overexpression Lysate(Denatured)

CNOT10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CNOT10 overexpression lysate

CNOT10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn