TA335601 Protein EFR3-like antibody

Rabbit Polyclonal Anti-EFR3A Antibody

See related secondary antibodies

Search for all "Protein EFR3-like"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Protein EFR3-like

Product Description for Protein EFR3-like

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Protein EFR3-like.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Protein EFR3-like

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EFR3A, KIAA0143, Protein EFR3 homolog A
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14156
Immunogen:
The immunogen for Anti-EFR3A Antibody is: synthetic peptide directed towards the C-terminal region of Human EFR3A. Synthetic peptide located within the following region: DTSGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESKANLLHDRLAQILELT.
GeneID:
23167
Application WB
Background This gene encodes a membrane protein. Studies with orthologous gene in mouse show that it is differentially expressed in the auditory brainstem neurons of mice with hearing deficit, compared to mice with normal hearing ability, suggesting a role for this gene in hearing.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Protein EFR3-like (2 products)

Catalog No. Species Pres. Purity   Source  

Protein EFR3-like

Protein EFR3-like Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Protein EFR3-like

Protein EFR3-like Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Protein EFR3-like (1 products)

Catalog No. Species Pres. Purity   Source  

EFR3A overexpression lysate

EFR3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn