TA335603 TMCC1 antibody

Rabbit Polyclonal Anti-TMCC1 Antibody

See related secondary antibodies

Search for all "TMCC1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TMCC1

Product Description for TMCC1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TMCC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMCC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0779, Transmembrane and coiled-coil domains protein 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94876
Immunogen:
The immunogen for Anti-TMCC1 Antibody: synthetic peptide directed towards the middle region of human TMCC1. Synthetic peptide located within the following region: YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK.
GeneID:
23023
Application WB
Background TMCC1 is a multi-pass membrane proteinPotential. It belongs to the TEX28 family.The exact function of TMCC1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMCC1 (1 products)

Catalog No. Species Pres. Purity   Source  

TMCC1 Lysate

Western Blot: TMCC1 Lysate [NBL1-16975] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for TMCC1.
  Novus Biologicals Inc.
  • LinkedIn