TA335606 BTBD3 antibody

Rabbit Polyclonal Anti-BTBD3 Antibody

See related secondary antibodies

Search for all "BTBD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rat BTBD3

Product Description for BTBD3

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rat BTBD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein 3, KIAA0952
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2F9
Immunogen:
The immunogen for Anti-BTBD3 Antibody: synthetic peptide directed towards the N terminal of human BTBD3. Synthetic peptide located within the following region: VDDKEKNMKCLTFFLMLPETVKNRSKKSSKKANTSSSSSNSSKLPPVCYE.
GeneID:
22903
Application WB
Background The exact function of BTBD3 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD3 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD3

BTBD3 Human Purified
  Abnova Taiwan Corp.

BTBD3

BTBD3 Human Purified
  Abnova Taiwan Corp.

Positive controls for BTBD3 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD3 293T Cell Transient Overexpression Lysate(Denatured)

BTBD3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BTBD3 overexpression lysate

BTBD3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn