TA335635 FAM32A antibody

Rabbit Polyclonal Anti-FAM32A Antibody

See related secondary antibodies

Search for all "FAM32A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat FAM32A

Product Description for FAM32A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat FAM32A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM32A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-144
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y421
Immunogen:
The immunogen for Anti-FAM32A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM32A. Synthetic peptide located within the following region: DKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKAS.
GeneID:
26017
Application WB
Background Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. FAM32A may also increase cell sensitivity to apoptotic stimuli.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM32A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM32A

FAM32A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FAM32A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM32A Lysate

Western Blot: FAM32A Lysate [NBL1-10519] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FAM32A
  Novus Biologicals Inc.
  • LinkedIn