TA335636 SSX2IP / ADIP antibody

Rabbit Polyclonal Anti-SSX2IP Antibody

See related secondary antibodies

Search for all "SSX2IP / ADIP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat SSX2IP / ADIP

TA335636

More Views

  • TA335636
  • TA335636

Product Description for SSX2IP / ADIP

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat SSX2IP / ADIP.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SSX2IP / ADIP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Afadin DIL domain-interacting protein, Afadin- and alpha-actinin-binding protein, KIAA0923, SSX2-interacting protein
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2D8
Immunogen:
The immunogen for Anti-SSX2IP Antibody: synthetic peptide directed towards the middle region of human SSX2IP. Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA.
GeneID:
117178
Application WB
IHC
Background SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneurol and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SSX2IP / ADIP (3 products)

Catalog No. Species Pres. Purity   Source  

SSX2IP / ADIP (full length, N-term HIS tag, transcript variant 5)

SSX2IP / ADIP Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

SSX2IP / ADIP

SSX2IP / ADIP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SSX2IP / ADIP

SSX2IP / ADIP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SSX2IP / ADIP (2 products)

Catalog No. Species Pres. Purity   Source  

SSX2IP 293T Cell Transient Overexpression Lysate(Denatured)

SSX2IP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SSX2IP overexpression lysate

SSX2IP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn