TA335643 MRF / C11orf9 antibody

Rabbit Polyclonal Anti-MYRF Antibody

See related secondary antibodies

Search for all "MRF / C11orf9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat MRF / C11orf9

Product Description for MRF / C11orf9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat MRF / C11orf9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRF / C11orf9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0954, Myelin gene regulatory factor, Uncharacterized protein C11orf9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2G1
Immunogen:
The immunogen for Anti-C11orf9 Antibody: synthetic peptide directed towards the N terminal of human C11orf9. Synthetic peptide located within the following region: GTGPPIKAEPKAPYAPGTLPDSPPDSGSEAYSPQQVNEPHLLRTITPETL.
GeneID:
745
Application WB
Background C11orf9 is a single-pass membrane protein.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn