TA335647 GTL3 / C16orf80 antibody

Rabbit Polyclonal Anti-C16orf80 Antibody

See related secondary antibodies

Search for all "GTL3 / C16orf80"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat GTL3 / C16orf80

Product Description for GTL3 / C16orf80

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat GTL3 / C16orf80.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GTL3 / C16orf80

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EVORF, UPF0468 protein C16orf80
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6A4
Immunogen:
The immunogen for Anti-C16orf80 Antibody: synthetic peptide directed towards the middle region of human C16orf80. Synthetic peptide located within the following region: IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICT.
GeneID:
29105
Application WB
Background The exact function of C16orf80 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTL3 / C16orf80 (1 products)

Catalog No. Species Pres. Purity   Source  

GTL3 / C16orf80

GTL3 / C16orf80 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for GTL3 / C16orf80 (1 products)

Catalog No. Species Pres. Purity   Source  

CFAP20 overexpression lysate

CFAP20 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn