TA335664 RNF2 antibody

Rabbit Polyclonal Anti-RNF2 Antibody

See related secondary antibodies

Search for all "RNF2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat RNF2

TA335664

More Views

  • TA335664

Product Description for RNF2

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat RNF2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RNF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BAP-1, BAP1, DING, E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, HIPI3, Protein DinG, RING finger protein 2, RING1B
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99496
Immunogen:
The immunogen for Anti-RNF2 Antibody: synthetic peptide directed towards the middle region of human RNF2. Synthetic peptide located within the following region: LVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGE.
GeneID:
6045
Application WB
IHC
Background Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by RNF2 is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF2 (5 products)

Catalog No. Species Pres. Purity   Source  

RNF2

RNF2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNF2

RNF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF2

RNF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF2

RNF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNF2

RNF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNF2 (2 products)

Catalog No. Species Pres. Purity   Source  

RNF2 Lysate

Western Blot: RNF2 Lysate [NBL1-15442] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RNF2
  Novus Biologicals Inc.

RNF2 overexpression lysate

RNF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn