TA335676 TRIM10 / RNF9 antibody

Rabbit Polyclonal Anti-TRIM10 Antibody

See related secondary antibodies

Search for all "TRIM10 / RNF9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat TRIM10 / RNF9

Product Description for TRIM10 / RNF9

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat TRIM10 / RNF9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM10 / RNF9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B30-RING finger protein, RFB30, RING finger protein 9, Tripartite motif-containing protein 10
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UDY6
Immunogen:
The immunogen for Anti-TRIM10 Antibody: synthetic peptide directed towards the middle region of human TRIM10. Synthetic peptide located within the following region: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT.
GeneID:
10107
Application WB
Background TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in termil differentiation of erythroid cells. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in termil differentiation of erythroid cells. Alterte splicing of this gene generates two transcript variants encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM10 / RNF9 (5 products)

Catalog No. Species Pres. Purity   Source  

TRIM10 / RNF9 (transcript variant 2)

TRIM10 / RNF9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIM10 / RNF9

TRIM10 / RNF9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRIM10 / RNF9

TRIM10 / RNF9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRIM10 / RNF9

TRIM10 / RNF9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM10 / RNF9

TRIM10 / RNF9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIM10 / RNF9 (4 products)

Catalog No. Species Pres. Purity   Source  

TRIM10 293T Cell Transient Overexpression Lysate(Denatured)

TRIM10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIM10 Lysate

Western Blot: TRIM10 Lysate [NBL1-17274] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIM10
  Novus Biologicals Inc.

TRIM10 overexpression lysate

TRIM10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TRIM10 overexpression lysate

TRIM10 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn