Galectin-8 - TA335681 | acris-antibodies.com

Product Description for Galectin-8

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Galectin-8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Galectin-8

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	Gal-8, Galectin8, LGALS8, PCTA-1, Po66 carbohydrate-binding protein, Po66-CBP, Prostate carcinoma tumor antigen 1
Presentation	Purified
Reactivity	Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: O00214 Immunogen: The immunogen for Anti-LGALS8 Antibody: synthetic peptide directed towards the C terminal of human LGALS8. Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD. GeneID: 3964
Application	WB
Background	LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and R splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and R splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Altertively spliced transcript variants encoding different isoforms have been identified.
Format	Purification: Affinity Purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Galectin-8 (11 products)

Catalog No.	Species	Pres.	Purity	Source
TP303752	Galectin-8 (transcript variant 3)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP320102	Galectin-8 (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP320163	Galectin-8 (transcript variant 2)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
AR09626PU-L	Galectin-8 (1-317, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	0.25 mg / €820.00
					OriGene Technologies GmbH
AR09626PU-N	Galectin-8 (1-317, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	50 µg / €320.00
					OriGene Technologies GmbH
H00003964-P01-10	Galectin-8
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003964-P01-25	Galectin-8
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003964-Q01-10	Galectin-8
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00003964-Q01-25	Galectin-8
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
NBP1-48335-0.250	Galectin-8
	Human	Purified
					Novus Biologicals Inc.
NBP1-48335-50	Galectin-8
	Human	Purified
					Novus Biologicals Inc.

Positive controls for Galectin-8 (8 products)

Catalog No.	Species
NBL1-12504	Galectin 8 Lysate

		Novus Biologicals Inc.
H00003964-T01	LGALS8 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY404450	LGALS8 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY404451	LGALS8 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY404452	LGALS8 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY416600	LGALS8 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY430871	LGALS8 overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.
LY430872	LGALS8 overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for Galectin-8 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH