TA335682 Podoplanin antibody

Rabbit Polyclonal Anti-PDPN Antibody

See related secondary antibodies

Search for all "Podoplanin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Podoplanin

TA335682

More Views

  • TA335682

Product Description for Podoplanin

Rabbit anti Human Podoplanin.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Podoplanin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Aggrus, GP36, Glycoprotein 36, PA2.26 antigen, PDPN, PSEC0003, PSEC0025, T1-alpha
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86YL7-3
Immunogen:
The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT.
GeneID:
10630
Application WB
IHC
Background PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Altertively spliced transcript variants encoding different isoforms have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Podoplanin (1 products)

Catalog No. Species Pres. Purity   Source  

Podoplanin

Podoplanin Human
  Abnova Taiwan Corp.
  • LinkedIn